NUP93 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NUP93 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4333
• Hersteller Artikelnummer: A4333
• Alternativnummer: ABB-A4333-100UL,ABB-A4333-20UL,ABB-A4333-500UL,ABB-A4333-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NIC96, NUP93

Produktbeschreibung

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene encodes a nucleoporin protein that localizes both to the basket of the pore and to the nuclear entry of the central gated channel of the pore. The encoded protein is a target of caspase cysteine proteases that play a central role in programmed cell death by apoptosis. Alternative splicing results in multiple transcript variants encoding different isoforms.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 93kDa
• NCBI: 9688
• UniProt: Q8N1F7
• Reinheit: Affinity purification
• Sequenz: IAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN
• Target-Kategorie: NUP93
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using NUP93 Rabbit pAb (A4333) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.