[KO Validated] TRIM25 Rabbit mAb, Unconjugated, Monoclonal

Produktübersicht

• Artikelname: [KO Validated] TRIM25 Rabbit mAb, Unconjugated, Monoclonal
• Artikelnummer: ABB-A4347
• Hersteller Artikelnummer: A4347
• Alternativnummer: ABB-A4347-100UL,ABB-A4347-20UL,ABB-A4347-500UL,ABB-A4347-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EFP, Z147, RNF147, ZNF147, 25

Produktbeschreibung

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein is an RNA binding protein, functions as a ubiquitin E3 ligase and is involved in multiple cellular processes, including regulation of antiviral innate immunity.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0971]
• Molekulargewicht: 71kDa
• NCBI: 7706
• UniProt: Q14258
• Reinheit: Affinity purification
• Sequenz: SPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEA
• Target-Kategorie: TRIM25
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Ubiquitin. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type(WT) and TRIM25 knockout (KO) 293T(KO) cells, using [KO Validated] TRIM25 Rabbit mAb (A4347) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.