ACE2 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A4612
Artikelname: ACE2 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A4612
Hersteller Artikelnummer: A4612
Alternativnummer: ABB-A4612-20UL,ABB-A4612-100UL,ABB-A4612-1000UL,ABB-A4612-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACEH, ACE2
The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. ACE2 is known to be expressed in various human organs, and its organ- and cell-specific expression suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronavirus HCoV-NL63 and the human severe acute respiratory syndrome coronaviruses, SARS-CoV and SARS-CoV-2, the latter is the causative agent of coronavirus disease-2019 (COVID-19). Multiple splice variants have been found for this gene and the dACE2 (or MIRb-ACE2) splice variant has been found to be interferon inducible.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50948]
Molekulargewicht: 92 kDa
NCBI: 59272
UniProt: Q9BYF1
Reinheit: Affinity purification
Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
Target-Kategorie: ACE2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IF-P,1:100 - 1:1000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Cardiovascular,Blood,Heart,Contractility. Shipping: Ice Bag
Western blot analysis of lysates from Rat kidney using ACE2 Rabbit mAb (A4612) at 1:4000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90 s.
Western blot analysis of various lysates using ACE2 Rabbit mAb (A4612) at 1:5000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Hep G2, HeLa.
Exposure time: 90 s.
Western blot analysis of lysates from Mouse kidney using ACE2 Rabbit mAb (A4612) at 1:4000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60 s.
Immunohistochemistry analysis of paraffin-embedded Human kidney using ACE2 Rabbit mAb (A4612) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human testis using ACE2 Rabbit mAb (A4612) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of Human kidney using ACE2 Rabbit mAb (A4612,dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.