AK3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A4694
- Bilder (1)
| Artikelname: | AK3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A4694 |
| Hersteller Artikelnummer: | A4694 |
| Alternativnummer: | ABB-A4694-100UL,ABB-A4694-20UL,ABB-A4694-1000UL,ABB-A4694-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AK6, FIX, AK3L1, AKL3L, AKL3L1, AK3 |
| The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 26kDa |
| NCBI: | 50808 |
| UniProt: | Q9UIJ7 |
| Reinheit: | Affinity purification |
| Sequenz: | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
| Target-Kategorie: | AK3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism. Shipping: Ice Bag |

