Calnexin Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A4846
Artikelname: Calnexin Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A4846
Hersteller Artikelnummer: A4846
Alternativnummer: ABB-A4846-100UL,ABB-A4846-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CNX, P90, IP90, Calnexin
This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0648]
Molekulargewicht: 68kDa
NCBI: 821
UniProt: P27824
Reinheit: Affinity purification
Sequenz: LPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Target-Kategorie: CANX
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Neuroscience,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using Calnexin Rabbit mAb (A4846) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.