HFE2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HFE2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5348
• Hersteller Artikelnummer: A5348
• Alternativnummer: ABB-A5348-20UL,ABB-A5348-100UL,ABB-A5348-500UL,ABB-A5348-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: JH, HFE2, RGMC, HFE2A

Produktbeschreibung

The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Two uORFs in the 5 UTR negatively regulate the expression and activity of the encoded protein. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 45kDa
• NCBI: 148738
• UniProt: Q6ZVN8
• Reinheit: Affinity purification
• Sequenz: MQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD
• Target-Kategorie: HJV
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat heart, using HFE2 Rabbit pAb (A5348) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.