Myelin oligodendrocyte glycoprotein Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5353
Artikelname: Myelin oligodendrocyte glycoprotein Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5353
Hersteller Artikelnummer: A5353
Alternativnummer: ABB-A5353-20UL,ABB-A5353-100UL,ABB-A5353-1000UL,ABB-A5353-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 4340
UniProt: Q16653
Reinheit: Affinity purification
Sequenz: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Target-Kategorie: MOG
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag
Western blot analysis of various lysates using Myelin oligodendrocyte glycoprotein Rabbit pAb (A5353) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.