RanGAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A5381
- Bilder (1)
| Artikelname: | RanGAP1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A5381 |
| Hersteller Artikelnummer: | A5381 |
| Alternativnummer: | ABB-A5381-20UL,ABB-A5381-100UL,ABB-A5381-1000UL,ABB-A5381-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SD, Fug1, RANGAP, RanGAP1 |
| This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 64kDa |
| NCBI: | 5905 |
| UniProt: | P46060 |
| Reinheit: | Affinity purification |
| Sequenz: | PQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV |
| Target-Kategorie: | RANGAP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |

