TFF2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5423
Artikelname: TFF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5423
Hersteller Artikelnummer: A5423
Alternativnummer: ABB-A5423-100UL,ABB-A5423-20UL,ABB-A5423-500UL,ABB-A5423-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SP, SML1, TFF2
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 7032
UniProt: Q03403
Reinheit: Affinity purification
Sequenz: EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Target-Kategorie: TFF2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from HT-29 cells, using TFF2 Rabbit pAb (A5423) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.