CBR1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CBR1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5446
• Hersteller Artikelnummer: A5446
• Alternativnummer: ABB-A5446-100UL,ABB-A5446-20UL,ABB-A5446-1000UL,ABB-A5446-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CBR, hCBR1, PG-9-KR, SDR21C1, CBR1

Produktbeschreibung

The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 30kDa
• NCBI: 873
• UniProt: P16152
• Reinheit: Affinity purification
• Sequenz: MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLA
• Target-Kategorie: CBR1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CBR1 Rabbit pAb (A5446) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.