ACVR1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5453
Artikelname: ACVR1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5453
Hersteller Artikelnummer: A5453
Alternativnummer: ABB-A5453-20UL,ABB-A5453-100UL,ABB-A5453-1000UL,ABB-A5453-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ALK4, SKR2, ACTRIB, ACVRLK4, ACVR1B
This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 91
UniProt: P36896
Reinheit: Affinity purification
Sequenz: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Target-Kategorie: ACVR1B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Microfilaments,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using ACVR1B Rabbit pAb (A5453) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.