APRT Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: APRT Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5456
• Hersteller Artikelnummer: A5456
• Alternativnummer: ABB-A5456-20UL,ABB-A5456-100UL,ABB-A5456-500UL,ABB-A5456-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AMP, APRTD, APRT

Produktbeschreibung

Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 20kDa
• NCBI: 353
• UniProt: P07741
• Reinheit: Affinity purification
• Sequenz: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
• Target-Kategorie: APRT
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from 293T cells, using CALCA Rabbit pAb (A5456) at 1:2500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.