OTX2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: OTX2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5475
• Hersteller Artikelnummer: A5475
• Alternativnummer: ABB-A5475-100UL,ABB-A5475-20UL,ABB-A5475-1000UL,ABB-A5475-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CPHD6, MCOPS5, OTX2

Produktbeschreibung

This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 32kDa
• NCBI: 5015
• UniProt: P32243
• Reinheit: Affinity purification
• Sequenz: TPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNA
• Target-Kategorie: OTX2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Neuroscience,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using OTX2 Rabbit pAb (A5475) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.