PSRC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A5484
- Bilder (1)
| Artikelname: | PSRC1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A5484 |
| Hersteller Artikelnummer: | A5484 |
| Alternativnummer: | ABB-A5484-100UL,ABB-A5484-20UL,ABB-A5484-500UL,ABB-A5484-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DDA3, FP3214, PSRC1 |
| This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 39kDa |
| NCBI: | 84722 |
| UniProt: | Q6PGN9 |
| Reinheit: | Affinity purification |
| Sequenz: | MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET |
| Target-Kategorie: | PSRC1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PSRC1 Rabbit pAb (A5484) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:90s. |
Produktgarantie und fachkundiger Support
