PSCA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5614
Artikelname: PSCA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5614
Hersteller Artikelnummer: A5614
Alternativnummer: ABB-A5614-100UL,ABB-A5614-20UL,ABB-A5614-1000UL,ABB-A5614-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PRO232, lncPSCA, PSCA
This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals, this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 8000
UniProt: O43653
Reinheit: Affinity purification
Sequenz: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Target-Kategorie: PSCA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates, using PSCA Rabbit pAb (A5614) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.