C9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A5622
- Bilder (1)
| Artikelname: | C9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A5622 |
| Hersteller Artikelnummer: | A5622 |
| Alternativnummer: | ABB-A5622-20UL,ABB-A5622-100UL,ABB-A5622-500UL,ABB-A5622-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C9D, ARMD15, C9 |
| This gene encodes the final component of the complement system. It participates in the formation of the Membrane Attack Complex (MAC). The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause component C9 deficiency. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 63kDa |
| NCBI: | 735 |
| UniProt: | P02748 |
| Reinheit: | Affinity purification |
| Sequenz: | QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLH |
| Target-Kategorie: | C9 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |

