CD105/Endoglin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A5639
- Bilder (1)
| Artikelname: | CD105/Endoglin Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A5639 |
| Hersteller Artikelnummer: | A5639 |
| Alternativnummer: | ABB-A5639-20UL,ABB-A5639-100UL,ABB-A5639-500UL,ABB-A5639-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | END, HHT1, ORW1, CD105/Endoglin |
| This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 71kDa |
| NCBI: | 2022 |
| UniProt: | P17813 |
| Reinheit: | Affinity purification |
| Sequenz: | ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK |
| Target-Kategorie: | ENG |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Immunology Inflammation,CDs,Stem Cells,Mesenchymal Stem Cells,Cardiovascular. Shipping: Ice Bag |

