OCA2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: OCA2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5653
• Hersteller Artikelnummer: A5653
• Alternativnummer: ABB-A5653-100UL,ABB-A5653-20UL,ABB-A5653-1000UL,ABB-A5653-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P, BEY, PED, BEY1, BEY2, BOCA, EYCL, HCL3, EYCL2, EYCL3, SHEP1, D15S12, OCA2

Produktbeschreibung

This gene encodes the human homolog of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine, which is a precursor to melanin synthesis. It is involved in mammalian pigmentation, where it may control skin color variation and act as a determinant of brown or blue eye color. Mutations in this gene result in type 2 oculocutaneous albinism. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 93kDa
• NCBI: 4948
• UniProt: Q04671
• Reinheit: Affinity purification
• Sequenz: MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV
• Target-Kategorie: OCA2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using OCA2 Rabbit pAb (A5653) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.