IL3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: IL3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5671
• Hersteller Artikelnummer: A5671
• Alternativnummer: ABB-A5671-20UL,ABB-A5671-100UL,ABB-A5671-500UL,ABB-A5671-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IL-3, MCGF, MULTI-CSF, IL3

Produktbeschreibung

The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 17kDa
• NCBI: 3562
• UniProt: P08700
• Reinheit: Affinity purification
• Sequenz: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Target-Kategorie: IL3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Growth factors,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using IL3 Rabbit pAb (A5671) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.