GCKR Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GCKR Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5678
• Hersteller Artikelnummer: A5678
• Alternativnummer: ABB-A5678-20UL,ABB-A5678-100UL,ABB-A5678-1000UL,ABB-A5678-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GKRP, FGQTL5, GCKR

Produktbeschreibung

This gene encodes a protein belonging to the GCKR subfamily of the SIS (Sugar ISomerase) family of proteins. The gene product is a regulatory protein that inhibits glucokinase in liver and pancreatic islet cells by binding non-covalently to form an inactive complex with the enzyme. This gene is considered a susceptibility gene candidate for a form of maturity-onset diabetes of the young (MODY).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 69kDa
• NCBI: 2646
• UniProt: Q14397
• Reinheit: Affinity purification
• Sequenz: MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLS
• Target-Kategorie: GCKR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Endocrine and metabolic diseases,Diabetes,Cardiovascular,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat liver using GCKR Rabbit pAb (A5678) at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 90 s.