GRB7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GRB7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5690
• Hersteller Artikelnummer: A5690
• Alternativnummer: ABB-A5690-100UL,ABB-A5690-20UL,ABB-A5690-500UL,ABB-A5690-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GRB7

Produktbeschreibung

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 60kDa
• NCBI: 2886
• UniProt: Q14451
• Reinheit: Affinity purification
• Sequenz: MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD
• Target-Kategorie: GRB7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using GRB7 Rabbit pAb (A5690) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.