RPS6KA5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5699
Artikelname: RPS6KA5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5699
Hersteller Artikelnummer: A5699
Alternativnummer: ABB-A5699-100UL,ABB-A5699-20UL,ABB-A5699-1000UL,ABB-A5699-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MSK1, RLPK, MSPK1, RPS6KA5
Enables ATP binding activity and protein serine/threonine kinase activity. Involved in several processes, including histone-serine phosphorylation, positive regulation of histone modification, and regulation of transcription, DNA-templated. Located in cytoplasm and nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 9252
UniProt: O75582
Reinheit: Affinity purification
Sequenz: TPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDS
Target-Kategorie: RPS6KA5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,Tyrosine kinases,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Endocrine Metabolism,Immunology Inflammation,NF-kB Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from C6 cells, using RPS6KA5 Rabbit pAb (A5699) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.