PDLIM5 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PDLIM5 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5720
• Hersteller Artikelnummer: A5720
• Alternativnummer: ABB-A5720-100UL,ABB-A5720-20UL,ABB-A5720-1000UL,ABB-A5720-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: L9, ENH, LIM, ENH1, PDLIM5

Produktbeschreibung

This gene encodes a member of a family of proteins that possess a 100-amino acid PDZ domain at the N terminus and one to three LIM domains at the C-terminus. This family member functions as a scaffold protein that tethers protein kinases to the Z-disk in striated muscles. It is thought to function in cardiomyocyte expansion and in restraining postsynaptic growth of excitatory synapses. Alternative splicing of this gene results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 64kDa
• NCBI: 10611
• UniProt: Q96HC4
• Reinheit: Affinity purification
• Sequenz: ASSVASTRSMPESLDSPTSGRPGVTSLTTAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCE
• Target-Kategorie: PDLIM5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Neuroscience,Calcium Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PDLIM5 Rabbit pAb (A5720) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.