FUT2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FUT2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5721
• Hersteller Artikelnummer: A5721
• Alternativnummer: ABB-A5721-100UL,ABB-A5721-20UL,ABB-A5721-500UL,ABB-A5721-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SE, Se2, sej, SEC2, B12QTL1, FUT2

Produktbeschreibung

This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. The encoded protein is important for the final step in the soluble ABO blood group antigen synthesis pathway. It is also involved in cell-cell interaction, cell surface expression, and cell proliferation. Mutations in this gene are a cause of the H-Bombay blood group where red blood cells lack the H antigen.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 39kDa
• NCBI: 2524
• UniProt: Q10981
• Reinheit: Affinity purification
• Sequenz: QQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGY
• Target-Kategorie: FUT2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism,Immunology Inflammation. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from HT-29 cells, using FUT2 Rabbit pAb (A5721) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.