Caspase-2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Caspase-2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5724
• Hersteller Artikelnummer: A5724
• Alternativnummer: ABB-A5724-100UL,ABB-A5724-20UL,ABB-A5724-1000UL,ABB-A5724-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ICH1, NEDD2, CASP-2, NEDD-2, PPP1R57, Caspase-2

Produktbeschreibung

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimers disease, Huntingtons disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 51kDa
• NCBI: 835
• UniProt: P42575
• Reinheit: Affinity purification
• Sequenz: KLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADML
• Target-Kategorie: CASP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Mitochondrial Control of Apoptosis,Ubiquitin,Endocrine Metabolism,Immunology Inflammation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using Caspase-2 Rabbit pAb (A5724) at 1:1000 dilution. Jurkat cells were treated with Staurosporine(1uM) at room temperature for 3 hours .
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.