CD155/PVR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5753
Artikelname: CD155/PVR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5753
Hersteller Artikelnummer: A5753
Alternativnummer: ABB-A5753-20UL,ABB-A5753-100UL,ABB-A5753-500UL,ABB-A5753-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PVS, HVED, CD155, NECL5, TAGE4, Necl-5, CD155/PVR
The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 5817
UniProt: P15151
Reinheit: Affinity purification
Sequenz: TCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNAI
Target-Kategorie: PVR
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates, using CD155/PVR Rabbit pAb (A5753) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.