TCN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A5755
- Bilder (1)
| Artikelname: | TCN2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A5755 |
| Hersteller Artikelnummer: | A5755 |
| Alternativnummer: | ABB-A5755-100UL,ABB-A5755-20UL,ABB-A5755-500UL,ABB-A5755-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | II, TC, TC2, TC-2, TCII, TC II, D22S676, D22S750, TCN2 |
| This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This plasma protein binds cobalamin and mediates the transport of cobalamin into cells. This protein and other mammalian cobalamin-binding proteins, such as transcobalamin I and gastric intrisic factor, may have evolved by duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 48kDa |
| NCBI: | 6948 |
| UniProt: | P20062 |
| Reinheit: | Affinity purification |
| Sequenz: | EMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANWHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPEGHFGNVYSTPLALQFLMTSPMRGAELGTACLKARVALLAS |
| Target-Kategorie: | TCN2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag |

