Granulin Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A5773
- Bilder (0)
| Artikelname: | Granulin Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A5773 |
| Hersteller Artikelnummer: | A5773 |
| Alternativnummer: | ABB-A5773-20UL,ABB-A5773-100UL,ABB-A5773-1000UL,ABB-A5773-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GEP, GP88, PEPI, PGRN, CLN11, PCDGF, Granulin |
| Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 64kDa |
| NCBI: | 2896 |
| UniProt: | P28799 |
| Reinheit: | Affinity purification |
| Sequenz: | CPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKL |
| Target-Kategorie: | GRN |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Neuroscience,Neurodegenerative Diseases. |
