ITGB3BP Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ITGB3BP Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5839
• Hersteller Artikelnummer: A5839
• Alternativnummer: ABB-A5839-20UL,ABB-A5839-100UL,ABB-A5839-500UL,ABB-A5839-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CENPR, NRIF3, TAP20, CENP-R, HSU37139, ITGB3BP

Produktbeschreibung

This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 20kDa
• NCBI: 23421
• UniProt: Q13352
• Reinheit: Affinity purification
• Sequenz: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQ
• Target-Kategorie: ITGB3BP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell Adhesion,Cytoskeleton. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse liver, using ITGB3BP Rabbit pAb (A5839) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.