CSTF1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CSTF1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5915
• Hersteller Artikelnummer: A5915
• Alternativnummer: ABB-A5915-20UL,ABB-A5915-100UL,ABB-A5915-1000UL,ABB-A5915-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CstF-50, CstFp50, CSTF1

Produktbeschreibung

This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5 UTR, but encoding the same protein, have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 48kDa
• NCBI: 1477
• UniProt: Q05048
• Reinheit: Affinity purification
• Sequenz: MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEML
• Target-Kategorie: CSTF1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CSTF1 Rabbit pAb (A5915) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.