FXR1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FXR1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5942
• Hersteller Artikelnummer: A5942
• Alternativnummer: ABB-A5942-100UL,ABB-A5942-20UL,ABB-A5942-1000UL,ABB-A5942-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FXR1P, CMYP9A, CMYP9B, MYOPMIL, MYORIBF, FXR1

Produktbeschreibung

The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 70kDa
• NCBI: 8087
• UniProt: P51114
• Reinheit: Affinity purification
• Sequenz: VTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL
• Target-Kategorie: FXR1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using FXR1 Rabbit pAb (A5942) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.