Aconitase 1 (ACO1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6008
Artikelname: Aconitase 1 (ACO1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6008
Hersteller Artikelnummer: A6008
Alternativnummer: ABB-A6008-100UL,ABB-A6008-20UL,ABB-A6008-1000UL,ABB-A6008-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IRP1, ACONS, HEL60, IREB1, IREBP, IREBP1, Aconitase 1 (ACO1)
The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5 UTR of ferritin mRNA, and in the 3 UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants
Klonalität: Polyclonal
Molekulargewicht: 98kDa
NCBI: 48
UniProt: P21399
Reinheit: Affinity purification
Sequenz: MRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDS
Target-Kategorie: ACO1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Endocrine Metabolism,Nucleotide metabolism,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using Aconitase 1 (ACO1) Rabbit pAb (A6008) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.