ST14 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ST14 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6135
• Hersteller Artikelnummer: A6135
• Alternativnummer: ABB-A6135-100UL,ABB-A6135-20UL,ABB-A6135-1000UL,ABB-A6135-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HAI, CAP3, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14, ST14

Produktbeschreibung

The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 95kDa
• NCBI: 6768
• UniProt: Q9Y5Y6
• Reinheit: Affinity purification
• Sequenz: TCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQ
• Target-Kategorie: ST14
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ST14 Rabbit pAb (A6135) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.