HDAC11 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HDAC11 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6140
• Hersteller Artikelnummer: A6140
• Alternativnummer: ABB-A6140-20UL,ABB-A6140-100UL,ABB-A6140-500UL,ABB-A6140-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HD11, HDAC11

Produktbeschreibung

This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 39kDa
• NCBI: 79885
• UniProt: Q96DB2
• Reinheit: Affinity purification
• Sequenz: GLSISPAGIVKRDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
• Target-Kategorie: HDAC11
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Wnt -Catenin Signaling Pathway,Immunology Inflammation,NF-kB Signaling Pathway,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using HDAC11 Rabbit pAb (A6140) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.