ETV7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ETV7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6255
• Hersteller Artikelnummer: A6255
• Alternativnummer: ABB-A6255-100UL,ABB-A6255-20UL,ABB-A6255-1000UL,ABB-A6255-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TEL2, TELB, TEL-2, ETV7

Produktbeschreibung

The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 39kDa
• NCBI: 51513
• UniProt: Q9Y603
• Reinheit: Affinity purification
• Sequenz: MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA
• Target-Kategorie: ETV7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ETV7 Rabbit pAb (A6255) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.