Annexin A4/Annexin IV Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6280
Artikelname: Annexin A4/Annexin IV Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6280
Hersteller Artikelnummer: A6280
Alternativnummer: ABB-A6280-100UL,ABB-A6280-20UL,ABB-A6280-1000UL,ABB-A6280-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274, Annexin A4/Annexin IV
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 307
UniProt: P09525
Reinheit: Affinity purification
Sequenz: IEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Target-Kategorie: ANXA4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Cytoskeleton,Neuroscience,Calcium Signaling,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using Annexin A4/Annexin IV Rabbit pAb (A6280) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.