PHF21A Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PHF21A Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6330
• Hersteller Artikelnummer: A6330
• Alternativnummer: ABB-A6330-20UL,ABB-A6330-100UL,ABB-A6330-500UL,ABB-A6330-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BHC80, NEDMS, BM-006, IDDBCS, PHF21A

Produktbeschreibung

The PHF21A gene encodes BHC80, a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC, see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 75kDa
• NCBI: 51317
• UniProt: Q96BD5
• Reinheit: Affinity purification
• Sequenz: TETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK
• Target-Kategorie: PHF21A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse liver, using PHF21A Rabbit pAb (A6330) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.