TCN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6414
- Bilder (1)
| Artikelname: | TCN1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6414 |
| Hersteller Artikelnummer: | A6414 |
| Alternativnummer: | ABB-A6414-100UL,ABB-A6414-20UL,ABB-A6414-500UL,ABB-A6414-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HC, TC1, TCI, TC-1, TCN1 |
| This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This protein is a major constituent of secondary granules in neutrophils and facilitates the transport of cobalamin into cells. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 48kDa |
| NCBI: | 6947 |
| UniProt: | P20061 |
| Reinheit: | Affinity purification |
| Sequenz: | EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQ |
| Target-Kategorie: | TCN1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |

