NR2C2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NR2C2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6422
• Hersteller Artikelnummer: A6422
• Alternativnummer: ABB-A6422-20UL,ABB-A6422-100UL,ABB-A6422-1000UL,ABB-A6422-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TR4, TAK1, NR2C2

Produktbeschreibung

This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 65kDa
• NCBI: 7182
• UniProt: P49116
• Reinheit: Affinity purification
• Sequenz: LIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPL
• Target-Kategorie: NR2C2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Cell Biology Developmental Biology,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from 293F cells, using NR2C2 Rabbit pAb (A6422) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.