NCR1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NCR1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6438
• Hersteller Artikelnummer: A6438
• Alternativnummer: ABB-A6438-20UL,ABB-A6438-100UL,ABB-A6438-1000UL,ABB-A6438-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LY94, CD335, NKP46, NK-p46, NCR1

Produktbeschreibung

Predicted to be involved in cellular defense response, regulation of natural killer cell mediated cytotoxicity, and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome, anogenital venereal wart, hepatitis C, and lymphoproliferative syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 9437
• UniProt: O76036
• Reinheit: Affinity purification
• Sequenz: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQ
• Target-Kategorie: NCR1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from HL-60 cells, using NCR1 Rabbit pAb (A6438) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.