RNF40 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RNF40 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6443
• Hersteller Artikelnummer: A6443
• Alternativnummer: ABB-A6443-100UL,ABB-A6443-20UL,ABB-A6443-500UL,ABB-A6443-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BRE1B, RBP95, STARING, RNF40

Produktbeschreibung

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 114kDa
• NCBI: 9810
• UniProt: O75150
• Reinheit: Affinity purification
• Sequenz: MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLAERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRIS
• Target-Kategorie: RNF40
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using RNF40 Rabbit pAb (A6443) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.