PHC3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PHC3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6479
• Hersteller Artikelnummer: A6479
• Alternativnummer: ABB-A6479-20UL,ABB-A6479-100UL,ABB-A6479-1000UL,ABB-A6479-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EDR3, HPH3, PHC3

Produktbeschreibung

Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in negative regulation of transcription, DNA-templated. Located in nucleoplasm. Part of PRC1 complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 106kDa
• NCBI: 80012
• UniProt: Q8NDX5
• Reinheit: Affinity purification
• Sequenz: LSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLISRSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSI
• Target-Kategorie: PHC3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PHC3 Rabbit pAb (A6479) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.