CGB5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6486
- Bilder (1)
| Artikelname: | CGB5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6486 |
| Hersteller Artikelnummer: | A6486 |
| Alternativnummer: | ABB-A6486-100UL,ABB-A6486-20UL,ABB-A6486-1000UL,ABB-A6486-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGB, HCG, hCGB, CGB5 |
| This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 18kDa |
| NCBI: | 93659 |
| UniProt: | P0DN86 |
| Reinheit: | Affinity purification |
| Sequenz: | ASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| Target-Kategorie: | CGB5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. Shipping: Ice Bag |

