IL9R Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: IL9R Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6630
• Hersteller Artikelnummer: A6630
• Alternativnummer: ABB-A6630-20UL,ABB-A6630-100UL,ABB-A6630-500UL,ABB-A6630-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD129, IL-9R, IL9R

Produktbeschreibung

The protein encoded by this gene is a cytokine receptor that specifically mediates the biological effects of interleukin 9 (IL9). The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor, gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines. The ligand binding of this receptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologic responses. This gene is located at the pseudoautosomal regions of X and Y chromosomes. Genetic studies suggested an association of this gene with the development of asthma. Multiple pseudogenes on chromosome 9, 10, 16, and 18 have been described. Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 57kDa
• NCBI: 3581
• UniProt: Q01113
• Reinheit: Affinity purification
• Sequenz: PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPA
• Target-Kategorie: IL9R
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using IL9R Rabbit pAb (A6630) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.