INTS10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6632
Artikelname: INTS10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6632
Hersteller Artikelnummer: A6632
Alternativnummer: ABB-A6632-100UL,ABB-A6632-20UL,ABB-A6632-1000UL,ABB-A6632-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: INT10, C8orf35, INTS10
INTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 55174
UniProt: Q9NVR2
Reinheit: Affinity purification
Sequenz: FLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILL
Target-Kategorie: INTS10
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using INTS10 Rabbit pAb (A6632) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.