INTS10 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: INTS10 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6632
• Hersteller Artikelnummer: A6632
• Alternativnummer: ABB-A6632-100UL,ABB-A6632-20UL,ABB-A6632-1000UL,ABB-A6632-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: INT10, C8orf35, INTS10

Produktbeschreibung

INTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 82kDa
• NCBI: 55174
• UniProt: Q9NVR2
• Reinheit: Affinity purification
• Sequenz: FLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILL
• Target-Kategorie: INTS10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using INTS10 Rabbit pAb (A6632) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.