MMP19 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MMP19 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6657
• Hersteller Artikelnummer: A6657
• Alternativnummer: ABB-A6657-100UL,ABB-A6657-20UL,ABB-A6657-1000UL,ABB-A6657-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CODA, MMP18, RASI-1, MMP19

Produktbeschreibung

This gene encodes a member of a family of proteins that are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded protein is secreted as an inactive proprotein, which is activated upon cleavage by extracellular proteases. Alternative splicing results in multiple transcript variants for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 57kDa
• NCBI: 4327
• UniProt: Q99542
• Reinheit: Affinity purification
• Sequenz: IAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPR
• Target-Kategorie: MMP19
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Cell Biology Developmental Biology,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from mouse lung, using MMP19 Rabbit pAb (A6657) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.