NUDC Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NUDC Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6678
• Hersteller Artikelnummer: A6678
• Alternativnummer: ABB-A6678-20UL,ABB-A6678-100UL,ABB-A6678-1000UL,ABB-A6678-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HNUDC, MNUDC, NPD011, NUDC

Produktbeschreibung

This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa
• NCBI: 10726
• UniProt: Q9Y266
• Reinheit: Affinity purification
• Sequenz: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWS
• Target-Kategorie: NUDC
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using NUDC Rabbit pAb (A6678) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.