RALB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6714
- Bilder (1)
| Artikelname: | RALB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6714 |
| Hersteller Artikelnummer: | A6714 |
| Alternativnummer: | ABB-A6714-100UL,ABB-A6714-20UL,ABB-A6714-1000UL,ABB-A6714-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RALB |
| This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 23kDa |
| NCBI: | 5899 |
| UniProt: | P11234 |
| Reinheit: | Affinity purification |
| Sequenz: | MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL |
| Target-Kategorie: | RALB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag |

