YB-1/YBX1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: YB-1/YBX1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6799
• Hersteller Artikelnummer: A6799
• Alternativnummer: ABB-A6799-100UL,ABB-A6799-20UL,ABB-A6799-500UL,ABB-A6799-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: YB1, BP-8, CSDB, DBPB, YB-1, CBF-A, CSDA2, EFI-A, NSEP1, NSEP-1, MDR-NF1, YB-1/YBX1

Produktbeschreibung

This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 4904
• UniProt: P67809
• Reinheit: Affinity purification
• Sequenz: MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVI
• Target-Kategorie: YBX1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,RNA Binding,Cell Biology Developmental Biology,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from 293T cells, using YB-1/YBX1 Rabbit pAb (A6799).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.