WRN Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: WRN Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6855
• Hersteller Artikelnummer: A6855
• Alternativnummer: ABB-A6855-20UL,ABB-A6855-100UL,ABB-A6855-1000UL,ABB-A6855-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RECQ3, RECQL2, RECQL3, WRN

Produktbeschreibung

This gene encodes a member of the RecQ subfamily of DNA helicase proteins. The encoded nuclear protein is important in the maintenance of genome stability and plays a role in DNA repair, replication, transcription and telomere maintenance. This protein contains a N-terminal 3 to 5 exonuclease domain, an ATP-dependent helicase domain and RQC (RecQ helicase conserved region) domain in its central region, and a C-terminal HRDC (helicase RNase D C-terminal) domain and nuclear localization signal. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by accelerated aging and an elevated risk for certain cancers.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 162kDa
• NCBI: 7486
• UniProt: Q14191
• Reinheit: Affinity purification
• Sequenz: CQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
• Target-Kategorie: WRN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using WRN Rabbit pAb (A6855) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.